Lineage for d4n0ka_ (4n0k A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1719636Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1719637Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1719638Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1719846Protein Mitochondrial cytochrome c [46642] (6 species)
  7. 1719847Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (57 PDB entries)
    Uniprot P00044
  8. 1719848Domain d4n0ka_: 4n0k A: [259387]
    automated match to d3tyia_
    complexed with hem, t3y

Details for d4n0ka_

PDB Entry: 4n0k (more details), 1.05 Å

PDB Description: Atomic resolution crystal structure of a cytochrome c-calixarene complex
PDB Compounds: (A:) Cytochrome c iso-1

SCOPe Domain Sequences for d4n0ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n0ka_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfkteclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate

SCOPe Domain Coordinates for d4n0ka_:

Click to download the PDB-style file with coordinates for d4n0ka_.
(The format of our PDB-style files is described here.)

Timeline for d4n0ka_: