Lineage for d2mpfa_ (2mpf A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2405483Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2405489Family b.82.3.2: cAMP-binding domain [51210] (13 protein domains)
    Pfam PF00027
  6. 2405640Protein automated matches [190352] (8 species)
    not a true protein
  7. 2405668Species Human (Homo sapiens) [TaxId:9606] [189505] (8 PDB entries)
  8. 2405680Domain d2mpfa_: 2mpf A: [259382]
    automated match to d3cl1a_

Details for d2mpfa_

PDB Entry: 2mpf (more details)

PDB Description: Solution structure human HCN2 CNBD in the cAMP-unbound state
PDB Compounds: (A:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2

SCOPe Domain Sequences for d2mpfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mpfa_ b.82.3.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvvsvlt
kgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmrrafe
tvaidrldrigkknsillh

SCOPe Domain Coordinates for d2mpfa_:

Click to download the PDB-style file with coordinates for d2mpfa_.
(The format of our PDB-style files is described here.)

Timeline for d2mpfa_: