SCOPe 2.08: Domain d2moea1: 2moe A:80-148

Lineage for d2moea1 (2moe A:80-148)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.10: DNA-binding domain [54170] (1 superfamily)
   beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.10.1: DNA-binding domain [54171] (5 families)

5. Family d.10.1.0: automated matches [254255] (1 protein)
   not a true family

6. Protein automated matches [254589] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255497] (2 PDB entries)

8. Domain d2moea1: 2moe A:80-148 [259379]
   Other proteins in same PDB: d2moea2
   automated match to d2ky8a_
   protein/DNA complex

Details for d2moea1

PDB Entry: 2moe

PDB Description: Solution structure of MBD4 methyl-cytosine binding domain bound to methylated DNA

PDB Compounds: (A:) Methyl-CpG-binding domain protein 4

SCOPe Domain Sequences for d2moea1:

Sequence; same for both SEQRES and ATOM records:

>d2moea1 d.10.1.0 (A:80-148) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tecrksvpcgwervvkqrlfgktagrfdvyfispqglkfrsksslanylhkngetslkpe
dfdftvlsk

Timeline for d2moea1:

• d2moea1 first appeared in SCOPe 2.04, called d2moea_
  
• d2moea1 appears in SCOPe 2.07