Lineage for d2moea1 (2moe A:80-148)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2499670Fold d.10: DNA-binding domain [54170] (1 superfamily)
    beta(3)-alpha; 2 layers: alpha/beta
  4. 2499671Superfamily d.10.1: DNA-binding domain [54171] (5 families) (S)
  5. 2499705Family d.10.1.0: automated matches [254255] (1 protein)
    not a true family
  6. 2499706Protein automated matches [254589] (3 species)
    not a true protein
  7. 2499709Species Human (Homo sapiens) [TaxId:9606] [255497] (2 PDB entries)
  8. 2499711Domain d2moea1: 2moe A:80-148 [259379]
    Other proteins in same PDB: d2moea2
    automated match to d2ky8a_
    protein/DNA complex

Details for d2moea1

PDB Entry: 2moe (more details)

PDB Description: Solution structure of MBD4 methyl-cytosine binding domain bound to methylated DNA
PDB Compounds: (A:) Methyl-CpG-binding domain protein 4

SCOPe Domain Sequences for d2moea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2moea1 d.10.1.0 (A:80-148) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tecrksvpcgwervvkqrlfgktagrfdvyfispqglkfrsksslanylhkngetslkpe
dfdftvlsk

SCOPe Domain Coordinates for d2moea1:

Click to download the PDB-style file with coordinates for d2moea1.
(The format of our PDB-style files is described here.)

Timeline for d2moea1: