![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.10: DNA-binding domain [54170] (1 superfamily) beta(3)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.10.1: DNA-binding domain [54171] (5 families) ![]() |
![]() | Family d.10.1.0: automated matches [254255] (1 protein) not a true family |
![]() | Protein automated matches [254589] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255497] (2 PDB entries) |
![]() | Domain d2moea1: 2moe A:80-148 [259379] Other proteins in same PDB: d2moea2 automated match to d2ky8a_ protein/DNA complex |
PDB Entry: 2moe (more details)
SCOPe Domain Sequences for d2moea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2moea1 d.10.1.0 (A:80-148) automated matches {Human (Homo sapiens) [TaxId: 9606]} tecrksvpcgwervvkqrlfgktagrfdvyfispqglkfrsksslanylhkngetslkpe dfdftvlsk
Timeline for d2moea1: