Lineage for d4mheb1 (4mhe B:2-69)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928974Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2928975Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2929386Family d.9.1.0: automated matches [191483] (1 protein)
    not a true family
  6. 2929387Protein automated matches [190775] (3 species)
    not a true protein
  7. 2929388Species Human (Homo sapiens) [TaxId:9606] [188003] (12 PDB entries)
  8. 2929410Domain d4mheb1: 4mhe B:2-69 [259371]
    Other proteins in same PDB: d4mhea2, d4mheb2
    automated match to d2vxwa_
    complexed with act

Details for d4mheb1

PDB Entry: 4mhe (more details), 2.1 Å

PDB Description: crystal structure of cc-chemokine 18
PDB Compounds: (B:) C-C motif chemokine 18

SCOPe Domain Sequences for d4mheb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mheb1 d.9.1.0 (B:2-69) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqvgtnkelcclvytswqipqkfivdysetspqcpkpgvilltkrgrqicadpnkkwvqk
yisdlkln

SCOPe Domain Coordinates for d4mheb1:

Click to download the PDB-style file with coordinates for d4mheb1.
(The format of our PDB-style files is described here.)

Timeline for d4mheb1: