SCOPe 2.08: Domain d4mheb1: 4mhe B:2-69

Lineage for d4mheb1 (4mhe B:2-69)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families)
   form dimers with different dimerisation modes

5. Family d.9.1.0: automated matches [191483] (1 protein)
   not a true family

6. Protein automated matches [190775] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188003] (12 PDB entries)

8. Domain d4mheb1: 4mhe B:2-69 [259371]
   Other proteins in same PDB: d4mhea2, d4mheb2
   automated match to d2vxwa_
   complexed with act

Details for d4mheb1

PDB Entry: 4mhe, 2.1 Å

PDB Description: crystal structure of cc-chemokine 18

PDB Compounds: (B:) C-C motif chemokine 18

SCOPe Domain Sequences for d4mheb1:

Sequence; same for both SEQRES and ATOM records:

>d4mheb1 d.9.1.0 (B:2-69) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqvgtnkelcclvytswqipqkfivdysetspqcpkpgvilltkrgrqicadpnkkwvqk
yisdlkln

Timeline for d4mheb1:

• d4mheb1 first appeared in SCOPe 2.04, called d4mheb_
  
• d4mheb1 appears in SCOPe 2.07