Lineage for d4mgkr_ (4mgk R:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1595370Protein automated matches [190047] (24 species)
    not a true protein
  7. 1595427Species Human (Homo sapiens) [TaxId:9606] [186768] (124 PDB entries)
  8. 1595648Domain d4mgkr_: 4mgk R: [259366]
    automated match to d4hdob_
    complexed with cmp, so4

Details for d4mgkr_

PDB Entry: 4mgk (more details), 2.7 Å

PDB Description: Selective activation of Epac1 and Epac2
PDB Compounds: (R:) Ras-related protein Rap-1b

SCOPe Domain Sequences for d4mgkr_:

Sequence, based on SEQRES records: (download)

>d4mgkr_ c.37.1.8 (R:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtagte
qftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdled
ervvgkeqgqnlarqwnncaflessakskinvneifydlvrq

Sequence, based on observed residues (ATOM records): (download)

>d4mgkr_ c.37.1.8 (R:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvqcmleildtagteqftam
rdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdledervvg
keqgqnlaflessakskinvneifydlvrq

SCOPe Domain Coordinates for d4mgkr_:

Click to download the PDB-style file with coordinates for d4mgkr_.
(The format of our PDB-style files is described here.)

Timeline for d4mgkr_: