Lineage for d4mbub_ (4mbu B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969437Species Staphylococcus aureus [TaxId:158878] [259363] (2 PDB entries)
  8. 2969443Domain d4mbub_: 4mbu B: [259364]
    Other proteins in same PDB: d4mbua2
    automated match to d3dr8b_
    complexed with cd, po4

Details for d4mbub_

PDB Entry: 4mbu (more details), 2.15 Å

PDB Description: crystal structure of n-acetyltransferase from staphylococcus aureus mu50
PDB Compounds: (B:) Similar to N-acetyltransferase

SCOPe Domain Sequences for d4mbub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mbub_ d.108.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158878]}
mircakkedlnailaiyndaiinttavytykpqtideriawfetkqrnhepifvfeengs
vlgfatfgsfrpwpayqytiehsiyvdasargkgiasqllqrliveakakgyrtlvagid
asneasiklhqkfnfkhagtltnvgykfdywldlafyeldlk

SCOPe Domain Coordinates for d4mbub_:

Click to download the PDB-style file with coordinates for d4mbub_.
(The format of our PDB-style files is described here.)

Timeline for d4mbub_: