SCOPe 2.04: Domain d4m7xa_: 4m7x A:

Lineage for d4m7xa_ (4m7x A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.14: Fumble-like [159623] (4 proteins)
   Pfam PF03630; type II pantothenate kinase-like

6. Protein automated matches [259360] (1 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:196620] [259361] (1 PDB entry)

8. Domain d4m7xa_: 4m7x A: [259362]
   automated match to d2ewsa1
   complexed with 27q, adp, mg, unx

Details for d4m7xa_

PDB Entry: 4m7x, 1.42 Å

PDB Description: staphylococcus aureus type ii pantothenate kinase in complex with a pantothenate analog

PDB Compounds: (A:) Type II pantothenate kinase

SCOPe Domain Sequences for d4m7xa_:

Sequence; same for both SEQRES and ATOM records:

>d4m7xa_ c.55.1.14 (A:) automated matches {Staphylococcus aureus [TaxId: 196620]}
mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen
inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg
ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl
hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy
tvlrgckpyyvengafsgaigalylekhhhhhh

Timeline for d4m7xa_:

• d4m7xa_ is new in SCOPe 2.04-stable
  
• d4m7xa_ appears in SCOPe 2.05
  
• d4m7xa_ appears in the current release, SCOPe 2.08, called d4m7xa1