SCOPe 2.08: Domain d4l6ca1: 4l6c A:32-227

Lineage for d4l6ca1 (4l6c A:32-227)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.8: 5'(3')-deoxyribonucleotidase (dNT-2) [82382] (2 proteins)
   the insertion subdomain is a 4-helical bundle; dephosphorylates dUMP and dTMP
   automatically mapped to Pfam PF06941

6. Protein automated matches [190171] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186899] (19 PDB entries)

8. Domain d4l6ca1: 4l6c A:32-227 [259359]
   Other proteins in same PDB: d4l6ca2
   automated match to d4l6aa_
   complexed with 0bt, edo, gol, mg, po4

Details for d4l6ca1

PDB Entry: 4l6c, 1.8 Å

PDB Description: Crystal structure of human mitochondrial deoxyribonucleotidase in complex with the inhibitor pib-t

PDB Compounds: (A:) 5'(3')-deoxyribonucleotidase, mitochondrial

SCOPe Domain Sequences for d4l6ca1:

Sequence; same for both SEQRES and ATOM records:

>d4l6ca1 c.108.1.8 (A:32-227) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggralrvlvdmdgvladfeggflrkfrarfpdqpfialedrrgfwvseqygrlrpglsek
aisiwesknfffeleplpgaveavkemaslqntdvfictspikmfkycpyekyawvekyf
gpdfleqivltrdktvvsadlliddrpditgaeptpswehvlftachnqhlqlqpprrrl
hswaddwkaildskrp

Timeline for d4l6ca1:

• d4l6ca1 first appeared in SCOPe 2.04, called d4l6ca_
  
• d4l6ca1 appears in SCOPe 2.07