SCOPe 2.06: Domain d4k8oa_: 4k8o A:

Lineage for d4k8oa_ (4k8o A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology

6. Protein automated matches [190723] (8 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187882] (4 PDB entries)

8. Domain d4k8oa_: 4k8o A: [259358]
   automated match to d2ixfa_
   complexed with atp, cit, mg, ni; mutant

Details for d4k8oa_

PDB Entry: 4k8o, 2.65 Å

PDB Description: crystal structure of the atpase domain of tap1 with atp (d645n, d651a mutant)

PDB Compounds: (A:) antigen peptide transporter 1

SCOPe Domain Sequences for d4k8oa_:

Sequence; same for both SEQRES and ATOM records:

>d4k8oa_ c.37.1.12 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gslaplnmkglvkfqdvsfaypnhpnvqvlqgltftlypgkvtalvgpngsgkstvaall
qnlyqptggkvlldgeplvqydhhylhtqvaavgqepllfgrsfreniaygltrtptmee
itavamesgahdfisgfpqgydtevgetgnqlsggqrqavalaralirkprllildnats
alaagnqlrvqrllyespewasrtvllitqqlslaerahhilflkegsvceqgthlqlme
rggcyrsmvealaa

Timeline for d4k8oa_:

• d4k8oa_ first appeared in SCOPe 2.04
  
• d4k8oa_ appears in SCOPe 2.05
  
• d4k8oa_ appears in SCOPe 2.07
  
• d4k8oa_ appears in the current release, SCOPe 2.08