SCOP 1.73: Domain d3btme_: 3btm E:

Lineage for d3btme_ (3btm E:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (271 PDB entries)

8. Domain d3btme_: 3btm E: [25935]
   Other proteins in same PDB: d3btmi_
   complexed with ca, so4; mutant

Details for d3btme_

PDB Entry: 3btm, 1.8 Å

PDB Description: the crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti

PDB Compounds: (E:) protein (trypsin)

SCOP Domain Sequences for d3btme_:

Sequence; same for both SEQRES and ATOM records:

>d3btme_ b.47.1.2 (E:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d3btme_:

• d3btme_ first appeared (with stable ids) in SCOP 1.55
  
• d3btme_ appears in SCOP 1.71
  
• d3btme_ appears in SCOP 1.75
  
• d3btme_ appears in the current release, SCOPe 2.08