Lineage for d4cz1d_ (4cz1 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850950Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2851461Superfamily c.8.8: Putative cyclase [102198] (2 families) (S)
    contains mixed beta-sheet barrel, closed n=7, S=10
  5. 2851472Family c.8.8.0: automated matches [238093] (1 protein)
    not a true family
  6. 2851473Protein automated matches [238095] (3 species)
    not a true protein
  7. 2851474Species Bacillus anthracis [TaxId:198094] [256229] (3 PDB entries)
  8. 2851486Domain d4cz1d_: 4cz1 D: [259348]
    automated match to d4co9a_
    complexed with mg, vnj, zn

Details for d4cz1d_

PDB Entry: 4cz1 (more details), 2.24 Å

PDB Description: crystal structure of kynurenine formamidase from bacillus anthracis complexed with 2-aminoacetophenone.
PDB Compounds: (D:) kynurenine formamidase

SCOPe Domain Sequences for d4cz1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cz1d_ c.8.8.0 (D:) automated matches {Bacillus anthracis [TaxId: 198094]}
skwidisqplnndiatwpgdtpfsyevlwskeesgsvnvgkltmsihtgthidapfhfdn
dgkkvldldiqvyvgptriidvsnlesigkkelekfhlegverlllrtsshgkanefpdi
iphlradiapflsekgirligvdvpsvdplddkelaahhqlfkhsihilenvvldhvadg
dyelialplalsdadgspvravirpi

SCOPe Domain Coordinates for d4cz1d_:

Click to download the PDB-style file with coordinates for d4cz1d_.
(The format of our PDB-style files is described here.)

Timeline for d4cz1d_: