SCOPe 2.06: Domain d4ch0s1: 4ch0 S:28-121

Lineage for d4ch0s1 (4ch0 S:28-121)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein automated matches [190332] (5 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [258944] (3 PDB entries)

8. Domain d4ch0s1: 4ch0 S:28-121 [259332]
   Other proteins in same PDB: d4ch0s2
   automated match to d2cqda1

Details for d4ch0s1

PDB Entry: 4ch0

PDB Description: rrm domain from c. elegans sup-12

PDB Compounds: (S:) protein sup-12, isoform b

SCOPe Domain Sequences for d4ch0s1:

Sequence; same for both SEQRES and ATOM records:

>d4ch0s1 d.58.7.1 (S:28-121) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
gsrdtmftkifvgglpyhtsdktlheyfeqfgdieeavvitdrntqksrgygfvtmkdra
saerackdpnpiidgrkanvnlaylgakprtnvq

Timeline for d4ch0s1:

• d4ch0s1 first appeared in SCOPe 2.04, called d4ch0s_
  
• d4ch0s1 was called d4ch0s_ in SCOPe 2.05
  
• d4ch0s1 appears in SCOPe 2.07
  
• d4ch0s1 appears in the current release, SCOPe 2.08