![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein automated matches [190332] (5 species) not a true protein |
![]() | Species Nematode (Caenorhabditis elegans) [TaxId:6239] [258944] (3 PDB entries) |
![]() | Domain d4ch0s1: 4ch0 S:28-121 [259332] Other proteins in same PDB: d4ch0s2 automated match to d2cqda1 |
PDB Entry: 4ch0 (more details)
SCOPe Domain Sequences for d4ch0s1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ch0s1 d.58.7.1 (S:28-121) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} gsrdtmftkifvgglpyhtsdktlheyfeqfgdieeavvitdrntqksrgygfvtmkdra saerackdpnpiidgrkanvnlaylgakprtnvq
Timeline for d4ch0s1: