Class b: All beta proteins [48724] (180 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.0: automated matches [191576] (1 protein) not a true family |
Protein automated matches [191011] (16 species) not a true protein |
Species Thermovibrio ammonificans [TaxId:228745] [259326] (2 PDB entries) |
Domain d4c3ta_: 4c3t A: [259330] automated match to d1koqa_ complexed with cl, zn |
PDB Entry: 4c3t (more details), 1.69 Å
SCOPe Domain Sequences for d4c3ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c3ta_ b.74.1.0 (A:) automated matches {Thermovibrio ammonificans [TaxId: 228745]} gahwgysgsigpehwgdlspeylmckigknqspidinsadavkaclapvsvyyvsdakyv vnnghtikvvmggrgyvvvdgkrfylkqfhfhapsehtvngkhypfeahfvhldkngnit vlgvffkvgkenpelekvwrvmpeepgqkrhltaridpekllpenrdyyrysgslttppc segvrwivfkepvemsreqlekfrkvmgfdnnrpvqplnarkvmk
Timeline for d4c3ta_: