Lineage for d4c0ca1 (4c0c A:32-478)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005985Species Trypanosoma cruzi [TaxId:5693] [196511] (10 PDB entries)
  8. 2005992Domain d4c0ca1: 4c0c A:32-478 [259324]
    Other proteins in same PDB: d4c0ca2
    automated match to d3khma_
    complexed with gol, hem, so4, wvh

Details for d4c0ca1

PDB Entry: 4c0c (more details), 2.04 Å

PDB Description: Crystal structure of Trypanosoma cruzi CYP51 bound to the inhibitor (R)-N-(3-(1H-indol-3-yl)-1-oxo-1-(pyridin-4-ylamino)propan-2-yl)-4-(4-(2,4-difluorophenyl)piperazin-1-yl)-2-fluorobenzamide.
PDB Compounds: (A:) Sterol 14-alpha demethylase

SCOPe Domain Sequences for d4c0ca1:

Sequence, based on SEQRES records: (download)

>d4c0ca1 a.104.1.0 (A:32-478) automated matches {Trypanosoma cruzi [TaxId: 5693]}
ppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdphehsrffs
prneilsprevytimtpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqhevr
kfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllskmesslipa
avfmpwllrlplpqsarcrearaelqkilgeiivarekeeaskdnntsdllggllkavyr
dgtrmslhevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefpaqln
ydnvmdempfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacspllshhde
eafpnprlwdperdekvdgafigfgagvhkcigqkfallqvktilatafreydfqllrde
vpdpdyhtmvvgptlnqclvkytrkkk

Sequence, based on observed residues (ATOM records): (download)

>d4c0ca1 a.104.1.0 (A:32-478) automated matches {Trypanosoma cruzi [TaxId: 5693]}
ppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdphehsrffs
prneilsprevytimtpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqhevr
kfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllskmesslipa
avfmpwllrlplpqsarcrearaelqkilgeiivarekeeastsdllggllkavyrdgtr
mslhevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefpaqlnydnv
mdempfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacspllshhdeeafp
nprlwdperdekvdgafigfgagvhkcigqkfallqvktilatafreydfqllrdevpdp
dyhtmvvgptlnqclvkytrkkk

SCOPe Domain Coordinates for d4c0ca1:

Click to download the PDB-style file with coordinates for d4c0ca1.
(The format of our PDB-style files is described here.)

Timeline for d4c0ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4c0ca2