SCOPe 2.08: Domain d4bl3b1: 4bl3 B:26-138

Lineage for d4bl3b1 (4bl3 B:26-138)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (35 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [256158] (3 PDB entries)

8. Domain d4bl3b1: 4bl3 B:26-138 [259319]
   Other proteins in same PDB: d4bl3a2, d4bl3a3, d4bl3b2, d4bl3b3
   automated match to d1vqqa1
   complexed with cd, cl, mur; mutant

Details for d4bl3b1

PDB Entry: 4bl3, 3 Å

PDB Description: crystal structure of pbp2a clinical mutant n146k from mrsa

PDB Compounds: (B:) penicillin binding protein 2 prime

SCOPe Domain Sequences for d4bl3b1:

Sequence; same for both SEQRES and ATOM records:

>d4bl3b1 d.17.4.0 (B:26-138) automated matches {Staphylococcus aureus [TaxId: 1280]}
kdkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrki
kkvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

Timeline for d4bl3b1:

• d4bl3b1 first appeared in SCOPe 2.04
  
• d4bl3b1 appears in SCOPe 2.07