Lineage for d3wgpa_ (3wgp A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009359Protein Vitamin D nuclear receptor [48528] (2 species)
  7. 2009360Species Human (Homo sapiens) [TaxId:9606] [48529] (28 PDB entries)
  8. 2009378Domain d3wgpa_: 3wgp A: [259316]
    automated match to d3b0ta_
    complexed with ed9

Details for d3wgpa_

PDB Entry: 3wgp (more details), 2 Å

PDB Description: Crystal Structure Analysis of Vitamin D receptor
PDB Compounds: (A:) Vitamin D3 receptor

SCOPe Domain Sequences for d3wgpa_:

Sequence, based on SEQRES records: (download)

>d3wgpa_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]}
lrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlphl
adlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcgn
qdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaa
lieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpec
smkltplvlevfg

Sequence, based on observed residues (ATOM records): (download)

>d3wgpa_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]}
lrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlphl
adlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcgn
qdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaa
lieaiqdrlsntlqtyircrhpppllyakmiqkladlrslneehskqyrclsfqpecsmk
ltplvlevfg

SCOPe Domain Coordinates for d3wgpa_:

Click to download the PDB-style file with coordinates for d3wgpa_.
(The format of our PDB-style files is described here.)

Timeline for d3wgpa_: