Lineage for d4uujc_ (4uuj C:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1696876Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 1696877Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families) (S)
  5. 1696878Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 1696975Protein automated matches [190184] (3 species)
    not a true protein
  7. 1696984Species Streptomyces lividans [TaxId:1916] [186922] (11 PDB entries)
  8. 1696993Domain d4uujc_: 4uuj C: [259308]
    Other proteins in same PDB: d4uuja1, d4uuja2, d4uujb1, d4uujb2
    automated match to d1r3jc_
    complexed with co, dga, f09, ind, k, po4, xa7

Details for d4uujc_

PDB Entry: 4uuj (more details), 2.4 Å

PDB Description: potassium channel kcsa-fab with tetrahexylammonium
PDB Compounds: (C:) voltage-gated potassium channel kcsa

SCOPe Domain Sequences for d4uujc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uujc_ f.14.1.1 (C:) automated matches {Streptomyces lividans [TaxId: 1916]}
aavalllgsalhwraagaatvllvivllagsylavlaergapgaqlitypralwwsveta
ttvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

SCOPe Domain Coordinates for d4uujc_:

Click to download the PDB-style file with coordinates for d4uujc_.
(The format of our PDB-style files is described here.)

Timeline for d4uujc_:

  • d4uujc_ appears in periodic updates to SCOPe 2.04 starting on 2014-08-27
  • d4uujc_ appears in SCOPe 2.05
  • d4uujc_ appears in the current release, SCOPe 2.07, called d4uujc1