SCOPe 2.08: Domain d4unua_: 4unu A:

Lineage for d4unua_ (4unu A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4unua_: 4unu A: [259306]
   automated match to d3t0xa_
   complexed with 15p, so4

Details for d4unua_

PDB Entry: 4unu, 0.95 Å

PDB Description: mcg - a dimer of lambda variable domains

PDB Compounds: (A:) ig lambda chain v-II region mgc

SCOPe Domain Sequences for d4unua_:

Sequence; same for both SEQRES and ATOM records:

>d4unua_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
saltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgvp
drfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvl

Timeline for d4unua_:

• d4unua_ first appeared in SCOPe 2.04
  
• d4unua_ appears in SCOPe 2.07