SCOPe 2.06: Domain d4un2b1: 4un2 B:328-369

Lineage for d4un2b1 (4un2 B:328-369)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (5 families)

5. Family a.5.2.1: UBA domain [46935] (25 proteins)

6. Protein automated matches [190533] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187496] (3 PDB entries)

8. Domain d4un2b1: 4un2 B:328-369 [259302]
   Other proteins in same PDB: d4un2a_, d4un2b2
   automated match to d1wr1b1

Details for d4un2b1

PDB Entry: 4un2, 1.51 Å

PDB Description: Crystal structure of the UBA domain of Dsk2 in complex with Ubiquitin

PDB Compounds: (B:) Ubiquitin domain-containing protein DSK2

SCOPe Domain Sequences for d4un2b1:

Sequence; same for both SEQRES and ATOM records:

>d4un2b1 a.5.2.1 (B:328-369) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
peeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsll

Timeline for d4un2b1:

• d4un2b1 first appeared in SCOPe 2.04, called d4un2b_
  
• d4un2b1 was called d4un2b_ in SCOPe 2.05
  
• d4un2b1 appears in SCOPe 2.07
  
• d4un2b1 appears in the current release, SCOPe 2.08