Lineage for d4u5wc_ (4u5w C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967561Fold d.102: Regulatory factor Nef [55670] (1 superfamily)
    alpha(2)-beta(4)-alpha; 3 layers: alpha/beta/alpha
  4. 2967562Superfamily d.102.1: Regulatory factor Nef [55671] (2 families) (S)
  5. 2967563Family d.102.1.1: Regulatory factor Nef [55672] (2 proteins)
    automatically mapped to Pfam PF00469
  6. 2967572Protein automated matches [191288] (2 species)
    not a true protein
  7. 2967573Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [189936] (4 PDB entries)
  8. 2967575Domain d4u5wc_: 4u5w C: [259301]
    Other proteins in same PDB: d4u5wb1, d4u5wd1, d4u5wd2, d4u5wd3
    automated match to d3reac_
    complexed with iod, mpd

Details for d4u5wc_

PDB Entry: 4u5w (more details), 1.86 Å

PDB Description: crystal structure of hiv-1 nef-sf2 core domain in complex with the src family kinase hck sh3-sh2 tandem regulatory domains
PDB Compounds: (C:) Protein Nef

SCOPe Domain Sequences for d4u5wc_:

Sequence, based on SEQRES records: (download)

>d4u5wc_ d.102.1.1 (C:) automated matches {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]}
gfpvrpqvplrpmtykaaldishflkekgglegliwsqrrqeildlwiyhtqgyfpdwqn
ytpgpgirypltfgwcfklvpvepekveeanegennsllhpmslhgmedaekevlvwrfd
sklafhhmarelhpeyyk

Sequence, based on observed residues (ATOM records): (download)

>d4u5wc_ d.102.1.1 (C:) automated matches {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]}
gfpvrpqvplrpmtykaaldishflkekgglegliwsqrrqeildlwiyhtqgyfpdwqn
ytpgpgirypltfgwcfklvpvepkevlvwrfdsklafhhmarelhpeyyk

SCOPe Domain Coordinates for d4u5wc_:

Click to download the PDB-style file with coordinates for d4u5wc_.
(The format of our PDB-style files is described here.)

Timeline for d4u5wc_: