Lineage for d4u1gc2 (4u1g C:112-215)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753381Domain d4u1gc2: 4u1g C:112-215 [259300]
    Other proteins in same PDB: d4u1gb_, d4u1gc1, d4u1ge_, d4u1gf1
    automated match to d1tqbc2

Details for d4u1gc2

PDB Entry: 4u1g (more details), 3.1 Å

PDB Description: plasmodium falciparum reticulocyte-binding protein homologue 5 (pfrh5) bound to monoclonal antibody qa1
PDB Compounds: (C:) QA1 monoclonal antibody light chain

SCOPe Domain Sequences for d4u1gc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u1gc2 b.1.1.2 (C:112-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d4u1gc2:

Click to download the PDB-style file with coordinates for d4u1gc2.
(The format of our PDB-style files is described here.)

Timeline for d4u1gc2: