| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d4u1gc1: 4u1g C:1-111 [259299] Other proteins in same PDB: d4u1gb_, d4u1gc2, d4u1ge_, d4u1gf2 automated match to d1a5fl1 |
PDB Entry: 4u1g (more details), 3.1 Å
SCOPe Domain Sequences for d4u1gc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4u1gc1 b.1.1.0 (C:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaslavslgqratiscrasqsvstssytyfhwyqqkpgqppklliryasnles
gvparfsgsgsgtdftlnihpveeedtatyycqhsweipytfgggtkleik
Timeline for d4u1gc1:
View in 3DDomains from other chains: (mouse over for more information) d4u1gb_, d4u1ge_, d4u1gf1, d4u1gf2 |