SCOPe 2.08: Domain d4u0qd2: 4u0q D:103-203

Lineage for d4u0qd2 (4u0q D:103-203)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4u0qd2: 4u0q D:103-203 [259298]
   automated match to d3b5hd1

Details for d4u0qd2

PDB Entry: 4u0q, 3.1 Å

PDB Description: Plasmodium falciparum reticulocyte-binding protein homologue 5 (PfRH5) bound to basigin

PDB Compounds: (D:) Basigin

SCOPe Domain Sequences for d4u0qd2:

Sequence; same for both SEQRES and ATOM records:

>d4u0qd2 b.1.1.0 (D:103-203) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpprvkavkssehinegetamlvcksesvppvtdwawykitdsedkalmngsesrffvss
sqgrselhienlnmeadpgqyrcngtsskgsdqaiitlrvr

Timeline for d4u0qd2:

• d4u0qd2 first appeared in SCOPe 2.04
  
• d4u0qd2 appears in SCOPe 2.07