Lineage for d4tv8e_ (4tv8 E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016286Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2016485Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2016486Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2016487Protein Stathmin 4 [101496] (1 species)
  7. 2016488Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (72 PDB entries)
  8. 2016498Domain d4tv8e_: 4tv8 E: [259296]
    Other proteins in same PDB: d4tv8a1, d4tv8a2, d4tv8b1, d4tv8b2, d4tv8c1, d4tv8c2, d4tv8d1, d4tv8d2, d4tv8f1, d4tv8f2, d4tv8f3
    automated match to d3ryce_
    complexed with 3gt, acp, ca, gdp, gol, gtp, mes, mg

Details for d4tv8e_

PDB Entry: 4tv8 (more details), 2.1 Å

PDB Description: Tubulin-Maytansine complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d4tv8e_:

Sequence, based on SEQRES records: (download)

>d4tv8e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d4tv8e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e

SCOPe Domain Coordinates for d4tv8e_:

Click to download the PDB-style file with coordinates for d4tv8e_.
(The format of our PDB-style files is described here.)

Timeline for d4tv8e_: