Class a: All alpha proteins [46456] (285 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.10: Stathmin [101494] (1 family) single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
Family a.137.10.1: Stathmin [101495] (1 protein) |
Protein Stathmin 4 [101496] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (25 PDB entries) |
Domain d4tv8e_: 4tv8 E: [259296] automated match to d3ryce_ complexed with 3gt, acp, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 4tv8 (more details), 2.1 Å
SCOPe Domain Sequences for d4tv8e_:
Sequence, based on SEQRES records: (download)
>d4tv8e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe kdkhaeevrknkelke
>d4tv8e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk e
Timeline for d4tv8e_: