Lineage for d4tuyb1 (4tuy B:1-245)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1843633Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1843634Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 1843635Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 1843745Protein automated matches [226837] (6 species)
    not a true protein
  7. 1843746Species Cow (Bos taurus) [TaxId:9913] [226564] (16 PDB entries)
  8. 1843768Domain d4tuyb1: 4tuy B:1-245 [259292]
    Other proteins in same PDB: d4tuya2, d4tuyb2, d4tuyc2, d4tuyd2, d4tuye_
    automated match to d4drxb1
    complexed with 36l, acp, ca, gdp, gtp, mes, mg

Details for d4tuyb1

PDB Entry: 4tuy (more details), 2.1 Å

PDB Description: Tubulin-Rhizoxin complex
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d4tuyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tuyb1 c.32.1.1 (B:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d4tuyb1:

Click to download the PDB-style file with coordinates for d4tuyb1.
(The format of our PDB-style files is described here.)

Timeline for d4tuyb1: