SCOPe 2.04: Domain d4tuyb1: 4tuy B:1-245

Lineage for d4tuyb1 (4tuy B:1-245)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (3 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226564] (14 PDB entries)

8. Domain d4tuyb1: 4tuy B:1-245 [259292]
   Other proteins in same PDB: d4tuyb2, d4tuyc2
   automated match to d4drxb1
   complexed with 36l, acp, ca, gdp, gtp, mes, mg

Details for d4tuyb1

PDB Entry: 4tuy, 2.1 Å

PDB Description: Tubulin-Rhizoxin complex

PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d4tuyb1:

Sequence; same for both SEQRES and ATOM records:

>d4tuyb1 c.32.1.1 (B:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

Timeline for d4tuyb1:

• d4tuyb1 is new in SCOPe 2.04-stable
  
• d4tuyb1 appears in SCOPe 2.05
  
• d4tuyb1 appears in the current release, SCOPe 2.08