Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (203 species) not a true protein |
Species Staphylococcus epidermidis [TaxId:1282] [258352] (2 PDB entries) |
Domain d4qecb_: 4qec B: [259284] automated match to d3v2hb_ complexed with nap, so4 |
PDB Entry: 4qec (more details), 1.9 Å
SCOPe Domain Sequences for d4qecb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qecb_ c.2.1.0 (B:) automated matches {Staphylococcus epidermidis [TaxId: 1282]} mkknvlitggfkgigkqvaleflkndyhvcitsryfekekriphlfssyeenisfyqldv tdeeqvneiinkivkkfgrldvlvnnagislsdglltetkttdfnkmintnilgtyfcmk yalkhmqkvscgaivnissitglsgfpysilygstkhavigltkgaavefadkgikinav apgiiktetlqkeidsgefsedsissihpmqklgttldvakgiyflanednnfitghvls idggylsq
Timeline for d4qecb_: