SCOPe 2.05: Domain d4qecb_: 4qec B:

Lineage for d4qecb_ (4qec B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Staphylococcus epidermidis [TaxId:1282] [258352] (2 PDB entries)

8. Domain d4qecb_: 4qec B: [259284]
   automated match to d3v2hb_
   complexed with nap, so4

Details for d4qecb_

PDB Entry: 4qec, 1.9 Å

PDB Description: ElxO with NADP Bound

PDB Compounds: (B:) ElxO

SCOPe Domain Sequences for d4qecb_:

Sequence; same for both SEQRES and ATOM records:

>d4qecb_ c.2.1.0 (B:) automated matches {Staphylococcus epidermidis [TaxId: 1282]}
mkknvlitggfkgigkqvaleflkndyhvcitsryfekekriphlfssyeenisfyqldv
tdeeqvneiinkivkkfgrldvlvnnagislsdglltetkttdfnkmintnilgtyfcmk
yalkhmqkvscgaivnissitglsgfpysilygstkhavigltkgaavefadkgikinav
apgiiktetlqkeidsgefsedsissihpmqklgttldvakgiyflanednnfitghvls
idggylsq

Timeline for d4qecb_:

• d4qecb_ first appeared in SCOPe 2.04
  
• d4qecb_ appears in SCOPe 2.06
  
• d4qecb_ appears in the current release, SCOPe 2.08