![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
![]() | Superfamily d.5.1: RNase A-like [54076] (2 families) ![]() can be classified as disulfide-rich |
![]() | Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
![]() | Protein automated matches [190061] (6 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [259282] (2 PDB entries) |
![]() | Domain d4qfja_: 4qfj A: [259283] automated match to d2bwla_ complexed with acy, h1s, zn |
PDB Entry: 4qfj (more details), 2.2 Å
SCOPe Domain Sequences for d4qfja_:
Sequence, based on SEQRES records: (download)
>d4qfja_ d.5.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} dprytkfltqhydakpkgrdarycesmmrrrgltspckevntfihgnkgsikaicgangs pygenlrisqspfqittckhtggsprppcryrasagfrhvviacenglpvhfdesf
>d4qfja_ d.5.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} dprytkfltqhydakpkgrdarycesmmrrrgltspckevntfihgnkgsikaicgangs pynlrisqspfqittckhtggsprppcryrasagfrhvviacenglpvhfdesf
Timeline for d4qfja_: