Lineage for d4q7jf1 (4q7j F:7-204)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2475344Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 2475351Species Escherichia coli [TaxId:562] [52627] (11 PDB entries)
    Uniprot P02990
  8. 2475368Domain d4q7jf1: 4q7j F:7-204 [259278]
    Other proteins in same PDB: d4q7ja1, d4q7ja2, d4q7ja3, d4q7jb2, d4q7jb3, d4q7je1, d4q7je2, d4q7je3, d4q7jf2, d4q7jf3
    automated match to d1d8ta3
    protein/RNA complex; complexed with so4

Details for d4q7jf1

PDB Entry: 4q7j (more details), 2.9 Å

PDB Description: complex structure of viral rna polymerase
PDB Compounds: (F:) Elongation factor Tu 1

SCOPe Domain Sequences for d4q7jf1:

Sequence, based on SEQRES records: (download)

>d4q7jf1 c.37.1.8 (F:7-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]}
rtkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintsh
veydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvg
vpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaewea
kilelagfldsyipeper

Sequence, based on observed residues (ATOM records): (download)

>d4q7jf1 c.37.1.8 (F:7-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]}
rtkphvnvgtighvdhgkttltaaittvlaktygtshveydtptrhyahvdcpghadyvk
nmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvddeellelv
emevrellsqydfpgddtpivrgsalkalegdaeweakilelagfldsyipeper

SCOPe Domain Coordinates for d4q7jf1:

Click to download the PDB-style file with coordinates for d4q7jf1.
(The format of our PDB-style files is described here.)

Timeline for d4q7jf1: