Lineage for d4pd0a2 (4pd0 A:499-653)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890089Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 2890090Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 2890232Family c.57.1.0: automated matches [191349] (1 protein)
    not a true family
  6. 2890233Protein automated matches [190284] (9 species)
    not a true protein
  7. 2890248Species Norway rat (Rattus norvegicus) [TaxId:10116] [259256] (9 PDB entries)
  8. 2890254Domain d4pd0a2: 4pd0 A:499-653 [259257]
    Other proteins in same PDB: d4pd0a1, d4pd0a3
    automated match to d1t3ea3

Details for d4pd0a2

PDB Entry: 4pd0 (more details), 1.7 Å

PDB Description: 1.7 a resolution structure of gephyrin's e-domain
PDB Compounds: (A:) gephyrin

SCOPe Domain Sequences for d4pd0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pd0a2 c.57.1.0 (A:499-653) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pvvavmstgnellnpeddllpgkirdsnrstllatiqehgyptinlgivgdnpddllnal
negisradviitsggvsmgekdylkqvldidlhaqihfgrvfmkpglpttfatldidgvr
kiifalpgnpvsavvtcnlfvvpalrkmqgildpr

SCOPe Domain Coordinates for d4pd0a2:

Click to download the PDB-style file with coordinates for d4pd0a2.
(The format of our PDB-style files is described here.)

Timeline for d4pd0a2: