Lineage for d4pd0a1 (4pd0 A:319-498)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1562555Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
    complex fold made of bifurcated and coiled b-sheets
  4. 1562556Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) (S)
    automatically mapped to Pfam PF03453
  5. 1562557Family b.103.1.1: MoeA N-terminal region -like [63883] (3 proteins)
  6. 1562605Protein automated matches [259253] (1 species)
    not a true protein
  7. 1562606Species Rattus norvegicus [TaxId:10116] [259254] (1 PDB entry)
  8. 1562607Domain d4pd0a1: 4pd0 A:319-498 [259255]
    Other proteins in same PDB: d4pd0a2, d4pd0a3
    automated match to d1t3ea2

Details for d4pd0a1

PDB Entry: 4pd0 (more details), 1.7 Å

PDB Description: 1.7 a resolution structure of gephyrin's e-domain
PDB Compounds: (A:) gephyrin

SCOPe Domain Sequences for d4pd0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pd0a1 b.103.1.1 (A:319-498) automated matches {Rattus norvegicus [TaxId: 10116]}
spfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgyav
raadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresdd
gteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnkf

SCOPe Domain Coordinates for d4pd0a1:

Click to download the PDB-style file with coordinates for d4pd0a1.
(The format of our PDB-style files is described here.)

Timeline for d4pd0a1: