Lineage for d4ny9a_ (4ny9 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009172Protein Pregnane x receptor, PXR [63624] (1 species)
  7. 2009173Species Human (Homo sapiens) [TaxId:9606] [63625] (16 PDB entries)
  8. 2009190Domain d4ny9a_: 4ny9 A: [259232]
    automated match to d1m13a_
    complexed with 2q4, gol

Details for d4ny9a_

PDB Entry: 4ny9 (more details), 2.8 Å

PDB Description: crystal structure of the human pxr-lbd in complex with n-{(2r)-1- [(4s)-4-(4-chlorophenyl)-4-hydroxy-3,3-dimethylpiperidin-1-yl]-3- methyl-1-oxobutan-2-yl}-3-hydroxy-3-methylbutanamide
PDB Compounds: (A:) Nuclear receptor subfamily 1 group I member 2

SCOPe Domain Sequences for d4ny9a_:

Sequence, based on SEQRES records: (download)

>d4ny9a_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]}
glteeqrmmirelmdaqmktfdttfshfknfrlpgvlssgcelpeslqapsreeaakwsq
vrkdlcslkvslqlrgedgsvwnykppadsggkeifsllphmadmstymfkgiisfakvi
syfrdlpiedqisllkgaafelcqlrfntvfnaetgtwecgrlsycledtaggfqqllle
pmlkfhymlkklqlheeeyvlmqaislfspdrpgvlqhrvvdqlqeqfaitlksyiecnr
pqpahrflflkimamltelrsinaqhtqrllriqdihpfatplmqelfgi

Sequence, based on observed residues (ATOM records): (download)

>d4ny9a_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]}
glteeqrmmirelmdaqmktfdttfshfknfrlpgqvrkdlcslkvslqlrgedgsvwny
kppadsggkeifsllphmadmstymfkgiisfakvisyfrdlpiedqisllkgaafelcq
lrfntvfnaetgtwecgrlsycleqqlllepmlkfhymlkklqlheeeyvlmqaislfsp
drpgvlqhrvvdqlqeqfaitlksyiecnrpqpahrflflkimamltelrsinaqhtqrl
lriqdihpfatplmqelfgi

SCOPe Domain Coordinates for d4ny9a_:

Click to download the PDB-style file with coordinates for d4ny9a_.
(The format of our PDB-style files is described here.)

Timeline for d4ny9a_: