Lineage for d4mstb_ (4mst B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2924182Family d.2.1.1: Family 19 glycosidase [53956] (2 proteins)
    automatically mapped to Pfam PF00182
  6. 2924190Protein automated matches [190455] (7 species)
    not a true protein
  7. 2924208Species Rubber tree (Hevea brasiliensis) [TaxId:3981] [259210] (1 PDB entry)
  8. 2924210Domain d4mstb_: 4mst B: [259211]
    automated match to d3w3ea_
    complexed with cl

Details for d4mstb_

PDB Entry: 4mst (more details), 1.93 Å

PDB Description: Crystal Structure of a putative catalytic domain of a chitinase-like protein (HbCLP1) from Hevea brasiliensis
PDB Compounds: (B:) Class I chitinase

SCOPe Domain Sequences for d4mstb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mstb_ d.2.1.1 (B:) automated matches {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}
siisrstfeemlkhrndaacpakgfytydafisaakafpafgttgdvdtckreiaaffgq
tshattggwptapdgpyawgycykeelnqassycspspaypcapgkkyygrgpiqlswny
nygqcgqalgldllnnpdlvatdrvisfkaaiwfwmtpqfpkpschdvitgqwsptghdi
sagrapgygvitniingglecgrgwdarvedrigfykrycdmfavgygsnldcynqtpfg

SCOPe Domain Coordinates for d4mstb_:

Click to download the PDB-style file with coordinates for d4mstb_.
(The format of our PDB-style files is described here.)

Timeline for d4mstb_: