![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
![]() | Family d.2.1.1: Family 19 glycosidase [53956] (2 proteins) automatically mapped to Pfam PF00182 |
![]() | Protein automated matches [190455] (7 species) not a true protein |
![]() | Species Rubber tree (Hevea brasiliensis) [TaxId:3981] [259210] (1 PDB entry) |
![]() | Domain d4mstb_: 4mst B: [259211] automated match to d3w3ea_ complexed with cl |
PDB Entry: 4mst (more details), 1.93 Å
SCOPe Domain Sequences for d4mstb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mstb_ d.2.1.1 (B:) automated matches {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} siisrstfeemlkhrndaacpakgfytydafisaakafpafgttgdvdtckreiaaffgq tshattggwptapdgpyawgycykeelnqassycspspaypcapgkkyygrgpiqlswny nygqcgqalgldllnnpdlvatdrvisfkaaiwfwmtpqfpkpschdvitgqwsptghdi sagrapgygvitniingglecgrgwdarvedrigfykrycdmfavgygsnldcynqtpfg
Timeline for d4mstb_: