Lineage for d4mq5a2 (4mq5 A:182-341)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1591787Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 1591788Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 1591815Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 1591839Protein Benzoylformate decarboxylase [52482] (1 species)
  7. 1591840Species Pseudomonas putida [TaxId:303] [52483] (34 PDB entries)
    Uniprot P20906
  8. 1591864Domain d4mq5a2: 4mq5 A:182-341 [259208]
    Other proteins in same PDB: d4mq5a1, d4mq5a3
    automated match to d1q6za1
    complexed with ca, na, tpp; mutant

Details for d4mq5a2

PDB Entry: 4mq5 (more details), 1.5 Å

PDB Description: Crystal Structure of Benzoylformate Decarboxylase Mutant A306F
PDB Compounds: (A:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d4mq5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mq5a2 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
pleafrapmgdaivadigamasalanlveessrqlptaap

SCOPe Domain Coordinates for d4mq5a2:

Click to download the PDB-style file with coordinates for d4mq5a2.
(The format of our PDB-style files is described here.)

Timeline for d4mq5a2: