SCOPe 2.04: Domain d4cz7b_: 4cz7 B:

Lineage for d4cz7b_ (4cz7 B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.53: p53 tetramerization domain [47718] (1 superfamily)
   core: 4 helices; bundle

4. Superfamily a.53.1: p53 tetramerization domain [47719] (2 families)
   homotetramer

5. Family a.53.1.0: automated matches [259188] (1 protein)
   not a true family

6. Protein automated matches [259190] (1 species)
   not a true protein

7. Species Danio rerio [TaxId:7955] [259192] (2 PDB entries)

8. Domain d4cz7b_: 4cz7 B: [259195]
   automated match to d3saka_
   complexed with gol, po4

Details for d4cz7b_

PDB Entry: 4cz7, 1.1 Å

PDB Description: truncated tetramerization domain of zebrafish p53 (crystal form iii)

PDB Compounds: (B:) Cellular tumor antigen p53

SCOPe Domain Sequences for d4cz7b_:

Sequence; same for both SEQRES and ATOM records:

>d4cz7b_ a.53.1.0 (B:) automated matches {Danio rerio [TaxId: 7955]}
gseeiftlqvrgreryeilkklndslelsdvv

Timeline for d4cz7b_:

• d4cz7b_ is new in SCOPe 2.04-stable
  
• d4cz7b_ appears in SCOPe 2.05
  
• d4cz7b_ appears in the current release, SCOPe 2.08, called d4cz7b1