SCOPe 2.05: Domain d4cexc1: 4cex C:1-131,C:435-483

Lineage for d4cexc1 (4cex C:1-131,C:435-483)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein)

6. Protein alpha-Subunit of urease [51340] (4 species)

7. Species Bacillus pasteurii [TaxId:1474] [51342] (9 PDB entries)

8. Domain d4cexc1: 4cex C:1-131,C:435-483 [259183]
   Other proteins in same PDB: d4cexa_, d4cexb_, d4cexc2
   automated match to d4ubpc1
   complexed with edo, f, ni, so4

Details for d4cexc1

PDB Entry: 4cex, 1.59 Å

PDB Description: 1.59 a resolution fluoride inhibited sporosarcina pasteurii urease

PDB Compounds: (C:) urease subunit alpha

SCOPe Domain Sequences for d4cexc1:

Sequence; same for both SEQRES and ATOM records:

>d4cexc1 b.92.1.1 (C:1-131,C:435-483) alpha-Subunit of urease {Bacillus pasteurii [TaxId: 1474]}
mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty
trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate
viaaegkivtaXlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmygt
v

Timeline for d4cexc1:

• d4cexc1 first appeared in SCOPe 2.04
  
• d4cexc1 appears in SCOPe 2.06
  
• d4cexc1 appears in the current release, SCOPe 2.08