Lineage for d4c1ha_ (4c1h A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231215Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2231216Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2231217Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2231218Protein Zn metallo-beta-lactamase [56283] (12 species)
  7. 2231231Species Bacillus cereus [TaxId:1396] [56284] (27 PDB entries)
    Uniprot P04190 31-257
  8. 2231232Domain d4c1ha_: 4c1h A: [259174]
    automated match to d1mqoa_
    complexed with gol, so4, x8z, zn

Details for d4c1ha_

PDB Entry: 4c1h (more details), 1.1 Å

PDB Description: crystal structure of the metallo-beta-lactamase bcii with l-captopril
PDB Compounds: (A:) Beta-lactamase 2

SCOPe Domain Sequences for d4c1ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c1ha_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]}
ktviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltk
eliemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplg
dlqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvaday
vnewstsienvlkryrninavvpghgevgdkglllhtldllk

SCOPe Domain Coordinates for d4c1ha_:

Click to download the PDB-style file with coordinates for d4c1ha_.
(The format of our PDB-style files is described here.)

Timeline for d4c1ha_: