Lineage for d4c1fb_ (4c1f B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996667Protein Zn metallo-beta-lactamase [56283] (14 species)
  7. 2996787Species Serratia marcescens [TaxId:615] [190018] (8 PDB entries)
  8. 2996800Domain d4c1fb_: 4c1f B: [259171]
    automated match to d1jjta_
    complexed with so4, x8z, zn

Details for d4c1fb_

PDB Entry: 4c1f (more details), 2.01 Å

PDB Description: crystal structure of the metallo-beta-lactamase imp-1 with l-captopril
PDB Compounds: (B:) beta-lactamase imp-1

SCOPe Domain Sequences for d4c1fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c1fb_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Serratia marcescens [TaxId: 615]}
lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf
vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny
wlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakll
kskygkaklvvpshsevgdasllkltleqavkglnes

SCOPe Domain Coordinates for d4c1fb_:

Click to download the PDB-style file with coordinates for d4c1fb_.
(The format of our PDB-style files is described here.)

Timeline for d4c1fb_: