Class b: All beta proteins [48724] (176 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
Protein automated matches [226946] (19 species) not a true protein |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [259160] (1 PDB entry) |
Domain d4c0sa2: 4c0s A:243-336 [259162] Other proteins in same PDB: d4c0sa1, d4c0sa3, d4c0sb1, d4c0sb3 automated match to d1f60a1 complexed with gdp, mg |
PDB Entry: 4c0s (more details), 2.7 Å
SCOPe Domain Sequences for d4c0sa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c0sa2 b.43.3.0 (A:243-336) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} dkplrlplqdvykiggigtvpvgrvetgilrpgmvvtfapvnittevksvemhhealsea lpgdnvgfnvknvsvkdirrgnvcgdsksdppqe
Timeline for d4c0sa2: