Lineage for d4c0sa2 (4c0s A:243-336)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1791673Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1791735Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1792044Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 1792045Protein automated matches [226946] (19 species)
    not a true protein
  7. 1792103Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [259160] (1 PDB entry)
  8. 1792104Domain d4c0sa2: 4c0s A:243-336 [259162]
    Other proteins in same PDB: d4c0sa1, d4c0sa3, d4c0sb1, d4c0sb3
    automated match to d1f60a1
    complexed with gdp, mg

Details for d4c0sa2

PDB Entry: 4c0s (more details), 2.7 Å

PDB Description: mammalian translation elongation factor eef1a2
PDB Compounds: (A:) Elongation factor 1-alpha 2

SCOPe Domain Sequences for d4c0sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c0sa2 b.43.3.0 (A:243-336) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
dkplrlplqdvykiggigtvpvgrvetgilrpgmvvtfapvnittevksvemhhealsea
lpgdnvgfnvknvsvkdirrgnvcgdsksdppqe

SCOPe Domain Coordinates for d4c0sa2:

Click to download the PDB-style file with coordinates for d4c0sa2.
(The format of our PDB-style files is described here.)

Timeline for d4c0sa2: