SCOPe 2.05: Domain d4c0sb1: 4c0s B:4-242

Lineage for d4c0sb1 (4c0s B:4-242)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [259156] (1 PDB entry)

8. Domain d4c0sb1: 4c0s B:4-242 [259159]
   Other proteins in same PDB: d4c0sa2, d4c0sa3, d4c0sb2, d4c0sb3
   automated match to d1f60a3
   complexed with gdp, mg

Details for d4c0sb1

PDB Entry: 4c0s, 2.7 Å

PDB Description: mammalian translation elongation factor eef1a2

PDB Compounds: (B:) Elongation factor 1-alpha 2

SCOPe Domain Sequences for d4c0sb1:

Sequence; same for both SEQRES and ATOM records:

>d4c0sb1 c.37.1.0 (B:4-242) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ekthinivvighvdsgkstttghliykcggidkrtiekfekeaaemgkgsfkyawvldkl
kaerergitidislwkfettkyyitiidapghrdfiknmitgtsqadcavlivaagvgef
eagiskngqtrehallaytlgvkqlivgvnkmdstepaysekrydeivkevsayikkigy
npatvpfvpisgwhgdnmlepspnmpwfkgwkverkegnasgvsllealdtilpptrpt

Timeline for d4c0sb1:

• d4c0sb1 first appeared in SCOPe 2.04
  
• d4c0sb1 appears in SCOPe 2.06
  
• d4c0sb1 appears in the current release, SCOPe 2.08