SCOPe 2.05: Domain d4c1id_: 4c1i D:

Lineage for d4c1id_ (4c1i D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (86 PDB entries)

8. Domain d4c1id_: 4c1i D: [259155]
   automated match to d3b2ra_
   complexed with eh9, mg, zn

Details for d4c1id_

PDB Entry: 4c1i, 2.4 Å

PDB Description: Selective Inhibitors of PDE2, PDE9, and PDE10: Modulators of Activity of the Central Nervous System

PDB Compounds: (D:) cgmp-dependent 3', 5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d4c1id_:

Sequence; same for both SEQRES and ATOM records:

>d4c1id_ a.211.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptla
rfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdldh
rgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmldl
mrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkttr
kiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlfpk
aaelyervasnrehwtkvs

Timeline for d4c1id_:

• d4c1id_ first appeared in SCOPe 2.04
  
• d4c1id_ appears in SCOPe 2.06
  
• d4c1id_ appears in the current release, SCOPe 2.08