SCOPe 2.08: Domain d3wu1a_: 3wu1 A:

Lineage for d3wu1a_ (3wu1 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.6: RUNT domain [81318] (2 proteins)
   automatically mapped to Pfam PF00853

6. Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species)
   synonym: core binding factor alpha, cbfa

7. Species Mouse (Mus musculus) [TaxId:10090] [63684] (14 PDB entries)
   almost identical sequence to the human protein

8. Domain d3wu1a_: 3wu1 A: [259150]
   Other proteins in same PDB: d3wu1b_
   automated match to d1h9da_
   protein/DNA complex

Details for d3wu1a_

PDB Entry: 3wu1, 2.4 Å

PDB Description: crystal structure of the ets1-runx1-dna ternary complex

PDB Compounds: (A:) runt-related transcription factor 1

SCOPe Domain Sequences for d3wu1a_:

Sequence; same for both SEQRES and ATOM records:

>d3wu1a_ b.2.5.6 (A:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Mouse (Mus musculus) [TaxId: 10090]}
ladhpgelvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndenys
aelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgpr
epr

Timeline for d3wu1a_:

• d3wu1a_ first appeared in SCOPe 2.04
  
• d3wu1a_ appears in SCOPe 2.07