![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.5: p53-like transcription factors [49417] (8 families) ![]() |
![]() | Family b.2.5.6: RUNT domain [81318] (2 proteins) automatically mapped to Pfam PF00853 |
![]() | Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species) synonym: core binding factor alpha, cbfa |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [63684] (14 PDB entries) almost identical sequence to the human protein |
![]() | Domain d3wtwa_: 3wtw A: [259149] Other proteins in same PDB: d3wtwb_, d3wtwc_, d3wtwg_ automated match to d1hjbc_ protein/DNA complex |
PDB Entry: 3wtw (more details), 2.9 Å
SCOPe Domain Sequences for d3wtwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wtwa_ b.2.5.6 (A:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Mouse (Mus musculus) [TaxId: 10090]} gelvrtdspnflcsvlpthwrcnktlpiafkvvakgdvpdgtlvtvmagndenysaelrn ataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraiaitvdgprepr
Timeline for d3wtwa_:
![]() Domains from other chains: (mouse over for more information) d3wtwb_, d3wtwc_, d3wtwf_, d3wtwg_ |