![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.21: ets domain [46859] (9 proteins) |
![]() | Protein automated matches [191121] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [193283] (15 PDB entries) |
![]() | Domain d3wtvc_: 3wtv C: [259145] Other proteins in same PDB: d3wtva_, d3wtvb_, d3wtvf_, d3wtvg_ automated match to d1gvjb_ protein/DNA complex |
PDB Entry: 3wtv (more details), 2.7 Å
SCOPe Domain Sequences for d3wtvc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wtvc_ a.4.5.21 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pvipaaalagytgsgpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkr knkpkmnyeklsrglryyydkniihktagkryvyrfvcdlqsllgytpeelhamldvk
Timeline for d3wtvc_:
![]() Domains from other chains: (mouse over for more information) d3wtva_, d3wtvb_, d3wtvf_, d3wtvg_ |