Lineage for d3wtzb_ (3wtz B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693426Family a.4.5.21: ets domain [46859] (9 proteins)
  6. 2693472Protein automated matches [191121] (2 species)
    not a true protein
  7. 2693473Species Human (Homo sapiens) [TaxId:9606] [193283] (15 PDB entries)
  8. 2693484Domain d3wtzb_: 3wtz B: [259141]
    automated match to d1gvjb_

Details for d3wtzb_

PDB Entry: 3wtz (more details), 2.61 Å

PDB Description: crystal structure of ets-1 dna binding and autoinhibitory domains (276-441)
PDB Compounds: (B:) Protein C-ets-1

SCOPe Domain Sequences for d3wtzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wtzb_ a.4.5.21 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgtfkdyvrdradlnkdkpvipaaalagytgsgpiqlwqfllelltdkscqsfiswtgdg
wefklsdpdevarrwgkrknkpkmnyeklsrglryyydkniihktagkryvyrfvcdlqs
llgytpeelhamldvk

SCOPe Domain Coordinates for d3wtzb_:

Click to download the PDB-style file with coordinates for d3wtzb_.
(The format of our PDB-style files is described here.)

Timeline for d3wtzb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3wtza_