Lineage for d4u5wd2 (4u5w D:146-246)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2206459Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2206460Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2206461Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2206697Protein Hemopoetic cell kinase Hck [55565] (1 species)
  7. 2206698Species Human (Homo sapiens) [TaxId:9606] [55566] (23 PDB entries)
  8. 2206699Domain d4u5wd2: 4u5w D:146-246 [259128]
    Other proteins in same PDB: d4u5wa_, d4u5wb1, d4u5wc_, d4u5wd1, d4u5wd3
    automated match to d1qcfa2
    complexed with iod, mpd

Details for d4u5wd2

PDB Entry: 4u5w (more details), 1.86 Å

PDB Description: crystal structure of hiv-1 nef-sf2 core domain in complex with the src family kinase hck sh3-sh2 tandem regulatory domains
PDB Compounds: (D:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d4u5wd2:

Sequence, based on SEQRES records: (download)

>d4u5wd2 d.93.1.1 (D:146-246) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcm

Sequence, based on observed residues (ATOM records): (download)

>d4u5wd2 d.93.1.1 (D:146-246) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdgsyslsvrdydprqgdtvkhykirtldng
gfyisprstfstlqelvdhykkgndglcqklsvpcm

SCOPe Domain Coordinates for d4u5wd2:

Click to download the PDB-style file with coordinates for d4u5wd2.
(The format of our PDB-style files is described here.)

Timeline for d4u5wd2: