SCOPe 2.04: Domain d4u5wd2: 4u5w D:146-248

Lineage for d4u5wd2 (4u5w D:146-248)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Hemopoetic cell kinase Hck [55565] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55566] (18 PDB entries)

8. Domain d4u5wd2: 4u5w D:146-248 [259128]
   Other proteins in same PDB: d4u5wa_, d4u5wb1, d4u5wd1
   automated match to d1qcfa2
   complexed with iod, mpd

Details for d4u5wd2

PDB Entry: 4u5w, 1.86 Å

PDB Description: crystal structure of hiv-1 nef-sf2 core domain in complex with the src family kinase hck sh3-sh2 tandem regulatory domains

PDB Compounds: (D:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d4u5wd2:

Sequence, based on SEQRES records:

>d4u5wd2 d.93.1.1 (D:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmle

Sequence, based on observed residues (ATOM records):

>d4u5wd2 d.93.1.1 (D:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdgsyslsvrdydprqgdtvkhykirtldng
gfyisprstfstlqelvdhykkgndglcqklsvpcmle

Timeline for d4u5wd2:

• d4u5wd2 is new in SCOPe 2.04-stable
  
• d4u5wd2 appears in SCOPe 2.05
  
• d4u5wd2 appears in the current release, SCOPe 2.08