![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.0: automated matches [227141] (1 protein) not a true family |
![]() | Protein automated matches [226843] (8 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [224936] (2 PDB entries) |
![]() | Domain d4u3jb2: 4u3j B:244-430 [259124] Other proteins in same PDB: d4u3ja1, d4u3jb1 automated match to d4ffbb2 complexed with gtp, mg |
PDB Entry: 4u3j (more details), 2.81 Å
SCOPe Domain Sequences for d4u3jb2:
Sequence, based on SEQRES records: (download)
>d4u3jb2 d.79.2.0 (B:244-430) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gqlnsdlrklavnlvpfprlhffmvgyapltaigsqsfrsltvpeltqqmfdaknmmaaa dprngryltvaaffrgkvsvkevedemhkvqsknsdyfvewipnnvqtavcsvapqgldm aatfianstsiqelfkrvgdqfsamfkrkaflhwytsegmdelefseaesnmndlvseyq qyqeatv
>d4u3jb2 d.79.2.0 (B:244-430) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gqlnsdlrklavnlvpfprlhffmvgyapltarsltvpeltqqmfdaknmmaaadprngr yltvaaffrgkvsvkevedemhkvqsknsdyfvewipnnvqtavcsvapqgldmaatfia nstsiqelfkrvgdqfsamfkrkaflhwytsegmdelefseaesnmndlvseyqqyqeat v
Timeline for d4u3jb2: